PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C017171P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family ZF-HD
Protein Properties Length: 97aa    MW: 10655.8 Da    PI: 8.2309
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C017171P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.62.6e-322885260
     ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                    ++vrY eC+kNhAa+lGg avDGC+Efm+  ge+gt +al+CaACgCHRnFHRrev+ e
  MELO3C017171P1 28 SEVRYAECQKNHAAKLGGFAVDGCREFMAR-GEDGTEEALNCAACGCHRNFHRREVDAE 85
                    579**************************8.999*********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257745.0E-27194IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.3E-293082IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015668.4E-273182IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.3623281IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048509Biological Processregulation of meristem development
Sequence ? help Back to Top
Protein Sequence    Length: 97 aa     Download sequence    Send to blast
MKKRLVVVKK SDGSNGRRNH HWSASSGSEV RYAECQKNHA AKLGGFAVDG CREFMARGED  60
GTEEALNCAA CGCHRNFHRR EVDAEVVFEY SPPNSN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818131e-162LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132561e-162LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453204.11e-66PREDICTED: mini zinc finger protein 3-like
SwissprotQ2Q4934e-37MIF3_ARATH; Mini zinc finger protein 3
TrEMBLA0A0A0LSA61e-63A0A0A0LSA6_CUCSA; Uncharacterized protein
STRINGfgenesh2_kg.1__2061__AT1G18835.11e-37(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF155034100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18835.12e-38mini zinc finger